PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0047s0014.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 317aa    MW: 34604.5 Da    PI: 4.8647
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0047s0014.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.49.7e-19237270134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          Cs+C++ kTp+WR gp+g ktLCnaCG+++++ +
  Kaladp0047s0014.1.p 237 CSHCQVQKTPQWRAGPEGAKTLCNACGVRFKSGR 270
                          *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.8E-7529313IPR016679Transcription factor, GATA, plant
SMARTSM004011.9E-16231285IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.334231267IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.04E-14232294No hitNo description
Gene3DG3DSA:3.30.50.103.6E-15234268IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.24E-14236285No hitNo description
PfamPF003201.1E-16237270IPR000679Zinc finger, GATA-type
PROSITE patternPS003440237262IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEYCIEARAL KPSLRREIDV RPNQSQAVAA VDEFVYETEV HGGGFVEDFL IDDLLDFPEK  60
EVEDGDEEEE EEKDSLSDCS AELETDENGY STVTGDFLSL PDDASGLAVP QDDLADLEWV  120
SRFVDDTMPE LPPLYPTKSG VSGRKPSVSS SLPVQLNQDI HIKPLIIPAK PRTKRQRIGR  180
VWSLNSSTAS ESSTTTSSSP SSIISSPVQF GFSGPLAKKQ KTKPDPAQPA DPTGRRCSHC  240
QVQKTPQWRA GPEGAKTLCN ACGVRFKSGR LYPEYRPACS PTFRGDVHSN SHRKVLEMRK  300
KKEAGAAGSG LAVQSY*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008236855.14e-78PREDICTED: GATA transcription factor 5-like
RefseqXP_008236856.14e-78PREDICTED: GATA transcription factor 5-like
TrEMBLD9ZIZ03e-74D9ZIZ0_MALDO; GATA domain class transcription factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.13e-52GATA transcription factor 7